PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001509.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 200aa    MW: 22847.8 Da    PI: 8.6539
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001509.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.3e-21666257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++R+++t+eql +Lee++++  r+p+a+++++++++l    +++ ++V++WFqN++a+e++
  Aco001509.1  6 STRWCPTPEQLMILEEMYRSgVRTPNATQIQQITAHLsyygRIEGKNVFYWFQNHKARERQ 66
                 58*****************99**************************************97 PP

2Wus_type_Homeobox123.48.5e-40567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaRerqk
        Aco001509.1  5 PSTRWCPTPEQLMILEEMYRSGVRTPNATQIQQITAHLSYYGRIEGKNVFYWFQNHKARERQK 67
                       589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.317267IPR001356Homeobox domain
SMARTSM003891.7E-5471IPR001356Homeobox domain
SuperFamilySSF466891.11E-11570IPR009057Homeodomain-like
CDDcd000863.78E-5567No hitNo description
PfamPF000468.9E-19666IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.1E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MPQAPSTRWC PTPEQLMILE EMYRSGVRTP NATQIQQITA HLSYYGRIEG KNVFYWFQNH  60
KARERQKLRR RLSRHYYHYQ HLLYTHPHPV IPTNFDPAVI SSTSPPPFLQ SNPTQFLHQG  120
GLQEATFGPN YCCKLDHGKS EGSFATNTED FGYEWTTKMG SDSAIPPCCR PLKTLDLFPT  180
KSTGLKDECN TSKSPSCFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910753.11e-72PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLM0TIL04e-72M0TIL0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P18230_0011e-71(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.16e-36WOX family protein